PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr10P06670_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family TALE
Protein Properties Length: 754aa    MW: 82381.6 Da    PI: 8.2909
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr10P06670_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.4e-095415781954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yp+ +++  LA+++gL+ +qV++WF N R +
  GSMUA_Achr10P06670_001 541 FEHflHPYPTDTDKHMLATQTGLSRNQVSNWFINARVR 578
                             554459******************************88 PP

2BELL111.45e-36397467272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             r e q+kkakLl+++ee+++rYkqy++q+q+v+ssFe vagl+sa+p tslAlkaiS+hFr+Lk+ai+eqi
  GSMUA_Achr10P06670_001 397 RSEFQQKKAKLLHMQEEICRRYKQYHQQMQMVVSSFESVAGLNSATPCTSLALKAISKHFRSLKNAISEQI 467
                             7899******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005748.8E-50341465IPR006563POX domain
PfamPF075268.5E-41347464IPR006563POX domain
PROSITE profilePS5007111.774519582IPR001356Homeobox domain
SMARTSM003894.3E-9522586IPR001356Homeobox domain
CDDcd000866.47E-12522583No hitNo description
Gene3DG3DSA:1.10.10.604.5E-28525586IPR009057Homeodomain-like
SuperFamilySSF466897.27E-17526589IPR009057Homeodomain-like
PfamPF059203.5E-18539578IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0010229Biological Processinflorescence development
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MLVGIILQLT ADVRRDLHRI MPFDWPEAWT WLLACVSASK ARKLLASKSQ PSPCHPPRAL  60
LSSCPLSLSL STVVPPPTHV SCGRAMNGLR QEAHVAQQSR RDKLRIPSHL LQLRDACDPP  120
MFSSSAAGAA PADFAAGSQV PLIVPSSSAI LGETAAALRG QPGCDWAVHP SLFPDNHSCH  180
QQPKPGFVGY HDGSMDLHYV SLPSPLPSQG RDFVSAVAQQ PCPWAIDSGG NELLFLPGYA  240
ADPANAMLMA RQPPPQWSGD LMSAKYEDAS AVGGSDLRVA RSLSLTLASS PVPELGAAQL  300
EAGPSCPYPK FLISDRVYDS GGSLQDVVTS PGGAAARHPF AGYAAFLKNS RFLRPTQQLL  360
DEFCCNSGAS TSTLYSSVEA GGERGAGSSS GVPKVHRSEF QQKKAKLLHM QEEICRRYKQ  420
YHQQMQMVVS SFESVAGLNS ATPCTSLALK AISKHFRSLK NAISEQIQNI SKVLGEELLS  480
SPSFSRGEAT TTPRSKYLDQ SLQKQKVGES TLSFTGYNQP VWKPQRGLPE RAVSVLRAWL  540
FEHFLHPYPT DTDKHMLATQ TGLSRNQVSN WFINARVRLW KPMIEEIHML ETKGTSGMDF  600
TSANAKHMMP GTDDGARPSM EPVFAADERS QEPWQGDKRS RVEESEMLMS FASYQHAMDI  660
GGIDAVSLTL GLRHEGGQQN PHQMEGRKGE RQNRSDGEKK LETKRKPPCP IDRSFPPSTI  720
LRRLELFDPS GLETDSVNSV RFRTPLGCSL LLLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16528586563Homeobox protein Meis2
3k2a_B4e-16528586563Homeobox protein Meis2
4xrm_A4e-16528586563Homeobox protein Meis2
4xrm_B4e-16528586563Homeobox protein Meis2
4xrs_A4e-16528585158Homeobox protein Meis1
4xrs_B4e-16528585158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420470.10.0PREDICTED: BEL1-like homeodomain protein 3
TrEMBLM0RFZ40.0M0RFZ4_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr10P06670_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP16049811
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.13e-77BEL1-like homeodomain 8